Perl Exercise #1 - Strings and variables. 

Here is are 3 lines of  protein sequence:

MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVE

ALYLVCGERGFFYTPKTRREAEDLQVGQVELGGGPGA

GSLQPLALEGSLQKRGIVEQCCTSICSLYQLENYCN
 

Make a Perl program that assigns each of these lines of text
to a different variable (a string; ie. $prot1, $prot2, $prot3)

Then use the "length" funtion of Perl to compute the length of the
each string and assign it to another variable ($prot1_length, etc.). 

Create  a new variable for the total length, add the first length to
this variable. Then add the length of the 2nd and 3rd lines (use the += operator).

Print the text of each string and its length and the total length of all 3 together.  

Now concatenate the 3 strings into one new string ($prot_full)
Use the length function again on this new string, 

Print the full protein and its length.

Test if the length of the joined string is greater than the length of the
sum of sum of the 3 shorter strings and print your result. 


Send me your program and a printout of its output when you run it.'
Make sure to include comments and try to get the output to format nicely
and describe itself.